GLP-2 Peptide (bs-0841P)

GLP-2 Peptide

Quantity size:

500ug

Sequence:

HADGSFSDEMNILDNLAADFINWLIQTKITD

Source:

Synthetic Peptide

Form:

lyophilized powde

Purity:

≥95% (Purified by HPLC)

Storage:

Shipped at 4℃, Store at -20℃ (Avoid repeated freeze/thaw cycles).

Application:

Biological activity
Immunology research

Background:

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.
GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.

Also known as:

Glucagan-like petide; glp-2; GCG; Glicentin; Glicentin related polypeptide; GLP 2; Glucagon like peptide 2; Glucagon precursor; Glucagon preproprotein; GRPP; OXM; OJNC; OJNCntomodulin; GLUC_HUMAN.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications.