GRP Peptide (bs-14364P)

GRP Peptide

Quantity size:

500ug

Sequence:

APVSTGAGGGTVLAKMYPRGSHWAVGHLM-NH2

Source:

Synthetic Peptide

Form:

lyophilized powde

Purity:

≥95% (Purified by HPLC)

Storage:

Shipped at 4℃, Store at -20℃ (Avoid repeated freeze/thaw cycles).

Application:

Biological activity
Immunology research
Blocking Peptide of The bs-14364R Antibody

Background:

This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. Its preproprotein, following cleavage of a signal peptide, is further processed to produce either the 27 aa gastrin-releasing peptide or the 10 aa neuromedin C. These smaller peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].

Also known as:

Gastrin releasing peptide; BN; Bombesin; GRP 10; GRP10; Neuromedin C; NeuromedinC; Pre progastrin releasing peptide; preproGRP; proGRP; GRP_HUMAN. Gastrin releasing peptide precursor.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications.