Anti-GRPP antibody (bs-10995R)

Anti-GRPP antibody

DATASHEET

Host:Rabbit

Target Protein:GRPP

IR:Immunogen Range:21-50/180

Clonality:Polyclonal

Isotype:IgG

Entrez Gene:2641

Swiss Prot:P01275

Source:KLH conjugated synthetic peptide derived from human GRPP(C-RSLQDTEEKSRSFSASQADPLSDPDQMNED):21-50/180 

Purification:affinity purified by Protein A

Storage:0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Shipped at 4℃. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles.

Background:The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq].

Size:100ul

Concentration:1mg/ml

Applications:ELISA(1:5000-10000)

Cross Reactive Species:Human
.

For research use only. Not intended for diagnostic or therapeutic use.